SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031959m|PACid:19709398 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031959m|PACid:19709398
Domain Number 1 Region: 28-79
Classification Level Classification E-value
Superfamily F-box domain 0.000000314
Family F-box domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si031959m|PACid:19709398
Sequence length 435
Sequence
RRRRRRGDRPKTRTASRKEASGLAATVHDVPDHLLELIFLRLDSCATVVRAGSACKRWCR
VLAGAGFLSRFGSLRAPVLAGHYHTVNPFFDSSPPPAGGMPGFVPSATTAATVNPRGFSL
DFLPDSKTWEIADSRGSLLLCKKTTPLASWTGYYYLPDQFIVCEPVTRRHQGILSPPYLQ
GECIGLFLLDGGDDNIRCSGGRRIGMSNFKILFVLHEFHRWVYGRGVPLACAFSSGSDGG
WRVLQSAASENVTVPHNIEQISFAGRAGGSAYWAIGEDGAMLVLDEATEGFSVVMFPEDL
LRSYDRYNFQVTGGEDGALRIVRLLNNELKVFARRHGSDDWVLENLVQLPEATRGLPGRQ
DRFFRQHEALIVAAESTHVLVTPQEKTWPFSVDLETMEVERARERNKYAGTAFPYELPWP
PVLMACAERGRRSRR
Download sequence
Identical sequences K3ZZC7
Si031959m|PACid:19709398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]