SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si034834m|PACid:19683746 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si034834m|PACid:19683746
Domain Number 1 Region: 268-369
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000129
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 45-184
Classification Level Classification E-value
Superfamily POZ domain 0.0000000275
Family BTB/POZ domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si034834m|PACid:19683746
Sequence length 588
Sequence
MEASTISFSSPSSSPQSTPPPPPPRATPTELEAVRLRRLSDNLERLLDPAFLDCADAEVA
LAAGKGGAAVGVHRCILAARSAFFRDHFASLPPPAAVGEKPRLELADLVPGGRHIGQDAL
VPVLGYLYTGRLKSAPQDATVCMDDACGHGACRPAIDFVVESMYAASGFQISELVSLFQR
RLSDFVSTALDEDVVPIVHVASTCELQDLLNQSLQRIAVSSLDSRYLEKELPDDIYCKIK
EIRQSVFHDESENAILDPEHEKRVRNILKALDSDDVDLVGLLLKESAVTLDDAFAVHYAA
AYCEPKVFAELLKLNSANVNLKNNSGYTPLHIACMRREPDIILSLVERGASVMERTPDGR
DAFTICKRLTREKDCNRKLEKCEEKSKAYLCIDILEQELKRKSFILDQISIEESIATPLL
VDNFHMRLINLENRVAFARIFFPSEAKLVMRIAQADSTEEFAGIRNFSKLKEVDLNETPT
MQNKRLRERLDALTKTVELGRRYFPHCSDVLDKFLIEESTDLIYLETGTPEDQHLKRMRF
SELKEDVRKAFTKDKAAVTAIASSASSSSSSRYEGRGRQSNRKSKQSR
Download sequence
Identical sequences K4A7H8
XP_004982222.1.39314 Si034834m|PACid:19683746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]