SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035480m|PACid:19682305 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035480m|PACid:19682305
Domain Number 1 Region: 95-130,175-383
Classification Level Classification E-value
Superfamily Kelch motif 3.53e-41
Family Kelch motif 0.0021
Further Details:      
 
Domain Number 2 Region: 44-92
Classification Level Classification E-value
Superfamily F-box domain 0.000000144
Family F-box domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si035480m|PACid:19682305
Sequence length 475
Sequence
MGAFLSSPTSKNQPREHGEAPGPESTKKLRLSSIPPSGHDHPRLIPGLPDEISLQILARM
PRMSYLKAKMVSRSWKTAITGAELYRLRKELGVAEEWLYILMKTADDQKLVWHAFDPVSN
QWQRLPLMPGISHRRGDCRSGVPGLGLGDLVSAGIRISDVIRSWFGHKDLLGSIPFCGCA
IGTVDGCLYVLGGFSRAFAMKCVWRYDPFVNSWQEVSPMSTGRAFCKTSLLNNKLYVVGG
VSKGKDGLTPLQSAEVFDPATGVWAEVPDMTFSKAQALPTAFLAELLKPIATGMTSYRGK
LYVPQSLYSWPFFVDVGGETFDPETNSWAEMPVGMGEGWPARQAGTKLSAVVDGDLYALE
PSTSSDSGKIKIYDPQGDTWKVAVSQVPVGDFAESESPYLLAGFLGKLHLIIKDVDNTII
MQTDLLKPTDSAAPSAGTTCQNPDVSFEKETDVWKAIASKNIAVAELISCQVLSI
Download sequence
Identical sequences K4A9C4
Si035480m|PACid:19682305 Si035485m|PACid:19682304 XP_004983240.1.39314 XP_004983241.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]