SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si035633m|PACid:19683329 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si035633m|PACid:19683329
Domain Number - Region: 19-83
Classification Level Classification E-value
Superfamily F-box domain 0.00392
Family F-box domain 0.0072
Further Details:      
 
Domain Number - Region: 82-156,193-328
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0641
Family Galactose oxidase, central domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si035633m|PACid:19683329
Sequence length 455
Sequence
MSPPLPCPKRARVATAPYGAGAPWASLPEDLVQLIGWRVLSGDLLDYVRFRAVCAHWSRS
AARPGGRGLLDPRFHPRRWMMLPEGHGLYPGHPALGGHVRFLNLSTGALARLHLPLFHDH
VILGCTDGLLLLLRHCDPGDTAVRLLHPFTGDVAELPPLSSLLPQMERYGDMTEYSKLSR
LRGFLSGVGAAVTVGPAAAGAITVVLALESKHLVAHATTGDQRWTLSASRLPRVLGRTVS
FHGNLYAVTPKFRQTNSVHIWQIDPPELDAAEGRTLLPPRIIAHCPLAAIPDAVHLVECG
SELMVVGFNDSKRTDLAVYRVADLISGRVVPITNIGEHALFLGTRPLYASQNKGLPSVVA
NSITCRYRVTKNDALRGGRPFRITEQYHIGTGTWSPATDEGISCWNEPPASPYMLIHHIF
TCCQHSYWNKGLIFHDKIKLDWSVKPNLWMYGLMD
Download sequence
Identical sequences K4A9S7
XP_004985311.1.39314 Si035633m|PACid:19683329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]