SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si040196m|PACid:19680850 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si040196m|PACid:19680850
Domain Number 1 Region: 120-205,346-392,423-483
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.66e-25
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 
Domain Number 2 Region: 201-272,304-342
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.93e-17
Family Calcium ATPase, transduction domain A 0.0064
Further Details:      
 
Domain Number 3 Region: 476-512
Classification Level Classification E-value
Superfamily HAD-like 0.00000766
Family Meta-cation ATPase, catalytic domain P 0.063
Further Details:      
 
Weak hits

Sequence:  Si040196m|PACid:19680850
Domain Number - Region: 495-525,562-626
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.085
Family Metal cation-transporting ATPase, ATP-binding domain N 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si040196m|PACid:19680850
Sequence length 631
Sequence
MDDVPARLPDPVPSPILRHSPANSVRRTRSLRSLLADSPSVTFAANLRSGSNASSLENFQ
FQRSGSRSASGTPAGLGRVSTRRSASERAGSQRDLRDEDARFVYINDADRTNAPPAGLPD
NSIHTTKYSVLTFLPRNLYEQFHRVAYLYFLVLVALNMVPQLGVLTPAASVLPLAFVLSV
TAVKDAYEDWRRHRSDKNENNREASVLVGGVFRPKRWKEIQVGEVLRVAANETLPCDMVL
LSTSDPTGVAYVQTINLDGESNLKTRYAKQETMPTPPEALAGVIKCERPNRNIYGFLATV
DLDGRRAVSLGPSNIVLRGCELKNTAWAVGVAVYTGRDTKVMLNSSGAPSKRSHLETHMN
RETIMLAVVLFLLCFIVALLAGIWLGDHSDDLAVIPFFRKRDFSSRDDPDAKYNWYGMGA
EVAFTFMKSVIQFQVMIPIALYISMEIVRVGQAFFMVQDRHMLDEKRQAKFQCRALNINE
DLGQIKYVFSDKTGTLTENRMEFRCASVHGADFSATDGGDGIVGDEHSVIGEDGMILRTK
TAVKTDPKLVALLRDGAGATADRARDFFLTLAACNTIVPIADDAAAGERLLEYQGESPDE
QALVYAAAAYGFTLVERTSGHIIVDVFGTRQ
Download sequence
Identical sequences K4AMQ0
Si040196m|PACid:19680850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]