SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OVOC1465 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OVOC1465
Domain Number - Region: 48-76
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0719
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OVOC1465
Sequence length 277
Comment pep:known supercontig:Cameroon_v3:OVOC_OM1b:10245754:10249317:-1 gene:WBGene00238274 transcript:OVOC1465 description:""
Sequence
MMVINEADNDAQISLVTPDNLHKSKLLHIRNSDLHLNANLQQIYIDGHETNNKTIDDDDQ
LIASNYAYDKLEQLTYQRQHFWSWQVILILLIIMIIINALIVFCLMNRDSNNKMATSIRF
VPLNDFRKRTLATFKLQSPKNVKLDDGMRNCQQLSSFVYCCVITANDNTSFRDKGTHCFR
QRSTDLFDHFYKKNMQMTQTWQTLSDDDTVVLLQNMAGGYAMLDTKYGISMPILDNEDYA
NLTPVVSFFGMDNVEELTALGNFNFFFPTFLKFLFND
Download sequence
Identical sequences OVOC1465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]