SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OVOC3741 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC3741
Domain Number 1 Region: 78-310
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 7.72e-77
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 5-78,315-513
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 8.88e-69
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OVOC3741
Sequence length 517
Comment pep:known supercontig:Cameroon_v3:OVOC_OM1b:27917547:27923464:1 gene:WBGene00240550 transcript:OVOC3741 description:"Independent phosphoglycerate mutase "
Sequence
MSEVKNRVCLVVIDGWGISNESKGNAILNAKTPVMDELCALNSHPIEAHGLHVGLPEGLM
GNSEVGHLNIGAGRVVYQDIVRINLAVKNKTLVENKHLKEAAERAIKGNGRIHLCGLVGV
SDGGVHSHIDHLFALITALKQLKVPQLYIHFFGDGRDTSPTSGVGFLQQLIDFVNKEQYG
EIATIVGRYYAMDRDKRWERIRVCYDALIAGVGEKTTIDKAIDVIKGRYAKDETDEFLKP
IILSDKGRTKDGDTLIFFDYRADRMREITECMGMERYKDLKSDIKHPKDMQVIGMTQYKA
EFTFPALFPPESHKNVLAEWLSVKGLTQFHCAETEKYAHVTFFFNGGVEKQFENEERCLV
PSPKVATYDLEPSMSSAEVADKMIEQLNRKAHAFIMCNFAPPDMVGHTGVYEAAVKAVEA
TDIAIGRIYEACKKNDYVLMVTADHGNAEKMIAPDGGKHTAHTCNLVPFTCSSLKFKFMD
KLPDREMALCDVAPTVLKVLGLPLPSEMTGKPVVIEV
Download sequence
Identical sequences A0A044T0T8
OVOC3741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]