SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OVOC5550 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC5550
Domain Number 1 Region: 872-1115
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000157
Family Tropomyosin 0.00066
Further Details:      
 
Domain Number 2 Region: 471-580
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000212
Family Myosin rod fragments 0.0071
Further Details:      
 
Domain Number 3 Region: 1233-1444
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000915
Family Tropomyosin 0.0023
Further Details:      
 
Weak hits

Sequence:  OVOC5550
Domain Number - Region: 1488-1588
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0115
Family Myosin rod fragments 0.0045
Further Details:      
 
Domain Number - Region: 1554-1666
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0157
Family Myosin rod fragments 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OVOC5550
Sequence length 1866
Comment pep:known supercontig:Cameroon_v3:OVOC_OM2:11766509:11781323:1 gene:WBGene00242359 transcript:OVOC5550 description:""
Sequence
MLFTCSGSANVKNQRVVVFGQEEFPQRPNSSVDDNRRGGLPSGRNSQGSASCPETFQTYA
SSSRRDSSSYLRSRSNSRSSSRTEILRPGQWTTVTSQIKFRTLTPSEQQEVFETQKKERL
LRKESSGEFYFCTNDSFRSVTSLPHLLPVITKMDEGADVSSGNQPTEMVSRVPDSPGSRS
SYGEFYWDTNGENVYHVSDSFDSDLMLEIDSYGKGVSAARLDRTQEDLHKYRQRIDANVE
HQKEYSDIISALQQKVQEYRRHIASLESRIAPRRPDEPSSFTLIDTTVYPDGKYRDETLW
SPKRGLDDTEYHLLAKLDEERRRVDDYRIQLEQERIQNDQLLHENERLRQQFETTMRENE
RIYKTRERNLAQYLSEEQKKMMDLWAELQRVRRQLIQHREQTEHDLENQRNEFTRIIRNV
GGLTRQLNLVGVEEKSAKDTALRHLDEIKRHLTNELDQQRTRYDTLNSEFDKLTNENENA
NKTIVTLEQTLREIKQQRDEYSKQKDELSRQIFDLKHQLDNEKATQEEAEKTRSRLMEEI
EKLKLQITDYENQLSMLRRHNDELDTQIKSGQAKITAIENDLITSQKEIARLNELNNRLQ
REKQDATNQKLKAESDVEILKEQIRKLEQEIEKLRTENRIITEQEEKTRDALTKETNRTH
LLQKELEEAKAEIEELLKKVKQLEQELESSSRSTRKDELDETDKISLVPSGPTVYDTEIV
EIKIREVNDKWKLEFDKLLGEKDELERRIRDLEDQIIQKNREIERQESETTELKRKHQEE
IDRLKSEISQLHDKHQSDLDDEKEQYNKNLESIKLVEDELRNKLAEAERKLAEAQNRENQ
LERDKAELKEKYEQALAQIQKLKDDLEDARQEAENEIQKWKTEVYTVRSELKATETANNA
LKTQLTAANERAESLNKTVNDQNAKIRDLNTQIRRLEEEVSDLKSAAVTRESDLESALGR
LRSVEDQYATLQSEHAKTRNELEISQREYDLLKSTNTNQESELERLRNKIQQYEVTIKEQ
KNALDHLKAERERLQNIYRDKMKQSEHLNQLVQSFDAKMNKMRQNLRDISDKFVAAETER
NALRSEVTKLQQELQFGKDQMVRRMDEYQSSLEDLANAHRAAEDGRLNALQELESRKYEL
ADLKNTEQRLTSLQHDYNKVENERDIMADSLKRFYSVTTHAVTLHKVKEDVDHDQLTETE
IPRSIPFPPTIEYTSTGERTGATTINIGETLDINQLENTLQTLISRIERLERERNEYREA
FDRLKKKTSDTHTTIHKKETRYKTIEENLTDMEEEKRALEVRLASAKQLLRSQEEALKQR
DEERRQLKAKIVAADLEARGKDAQLRHLNEQLKNLRNDLETAQADLRSLREREEQWDGNR
FQLESKLRDKESETQRLILLQTNLESEKQSLNERIKELSGQLQLSDIKCTDMKEDMERLK
RELSKAESVEMELRKTSDYQSRTINEYQILRDQITSAQNDLANANYQKQQLEHELTTARG
ELRDFKQRMRDLNGRASDLQRQLQDASAEKNRLEERLVTLEKDDDKLQTTTSQRATEDDL
RQQIETYKSERRTLQRELEELQRRLAQLENEKRAVVGQFETCKRDRVTFIKKIEMMENEK
RRTDTAIRETALQREAIEKSLNAMERENKELYKNCAQLQKQIAQLEFENGNRIIEITNKQ
REEQDKQLQRMRNEKIQIERIIENRERTQQNRIKQLENQLSIMREQLDNERRRRRDYVDR
SLAGDIGRLGGGYLGLRSTGIHSAGVIPHLGDDYLSGTTRYVRSTFASNPLTPPLGTSTP
TRYQDMQRESYTSTSAYHPSMVGSTTSDKIKLETLEPSKEIEERRTKTVIVMKSSRLGDN
VENKAD
Download sequence
Identical sequences OVOC5550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]