SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hypbu1|144820|estExt_Genewise1Plus.C_9_t10224 from Hyphopichia burtonii NRRL Y-1933 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hypbu1|144820|estExt_Genewise1Plus.C_9_t10224
Domain Number 1 Region: 599-710
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000196
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Hypbu1|144820|estExt_Genewise1Plus.C_9_t10224
Sequence length 803
Sequence
MSARNTNDPPRSGSSSQISKSSNSEPSYRKISNKRVNTESSSLLRSQASNDINVLADANG
DNTDGTPPTEYEPTRTRTIDNLPWNVVLPYYLPILSWVPEYNISYFLGDLVGGISLATFQ
IPLCISYATSLAHVPITCGLFSLGIAPLIYMVFGSVPQMVVGPEAPISLIVGQAVEPLLH
HAKKKNLDPIEYVVAITLVSGASLLGFGLGRFGFLDNVLSESLLKGFISGVGIVMIINAS
ISMLGLDELLKQVRGDPELPDIHSPFDKLTFLVHYFKEFHKLTLIISLVGFIVIMALRSF
KKQATKSQNHLYQKLIYIPEILIVTCLATWLSQVNRWDQKGIDIIGEIKNRDDSFTFYNP
FLHNVVKYIKFLSSSGFLCAMLGFFESTTASKSLGSIYNLPISSNRELVALGFINVTGSV
FGALPAFGGYGRSKINAISAKTTTSGAIMGAIALVTANSICDYLYFVPKCILSVITCVIG
ISLIDEAPYELWFHWKSRGYNELVTFAITVLTTVFFSMETGIAVGLIYLLIRVIKHSAES
RIQILGRYPGTNTFLDADLSRNSRSIAQGRNSPNLEKNRRSQYNVFTDDNFRELNVQALE
EIEGCLIIKIPEPLSFVNTNDLKTRLKRVEMYGSTRAHPALKRSRDSSMTKYIIFDLDGM
TELDSSAAQILLKLLQNYEERGIRSFFVRVIEDRHLKQRLIATGIAKLLTRHLELMKYFD
YQASSPNRRLNRFDAGETASLQGDDIDTADDTSSLDRLIGEYEEPYFSHISDALKIIDHY
EGLNKDDESLIERDSEFGDHSMV
Download sequence
Identical sequences A0A1E4RC78
jgi|Hypbu1|144820|estExt_Genewise1Plus.C_9_t10224 XP_020073921.1.17418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]