SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Hypbu1|154194|fgenesh1_kg.9_#_71_#_Locus1536v1rpkm92.02 from Hyphopichia burtonii NRRL Y-1933 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hypbu1|154194|fgenesh1_kg.9_#_71_#_Locus1536v1rpkm92.02
Domain Number 1 Region: 56-130
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 9.55e-29
Family Skp1 dimerisation domain-like 0.0000253
Further Details:      
 
Domain Number 2 Region: 3-38
Classification Level Classification E-value
Superfamily POZ domain 0.000000122
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Hypbu1|154194|fgenesh1_kg.9_#_71_#_Locus1536v1rpkm92.02
Sequence length 133
Sequence
MINDLNPDGLTEDFEVPTPNVRSSVLAKVLEWCEHHKHTVFPDDDDEDAKKSAPVDEWDR
NFLKVDQEMLYEIMLAANYLNIRPLLDAGCKTVAEMIRNKSPEELRRTFNIVNDFSPEEE
AAIRRENEWAEDR
Download sequence
Identical sequences A0A1E4RC87
jgi|Hypbu1|154194|fgenesh1_kg.9_#_71_#_Locus1536v1rpkm92.02 XP_020073956.1.17418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]