SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR270W from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR270W
Domain Number 1 Region: 151-240
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.8e-22
Family Calcium ATPase, transduction domain A 0.003
Further Details:      
 
Domain Number 2 Region: 345-369,408-554
Classification Level Classification E-value
Superfamily HAD-like 1.32e-16
Family Meta-cation ATPase, catalytic domain P 0.0097
Further Details:      
 
Domain Number 3 Region: 110-142,242-349
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000275
Family Calcium ATPase, transmembrane domain M 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR270W
Sequence length 558
Comment CCC2 ORF Verified Cu(+2)-transporting P-type ATPase, required for export of copper from the cytosol into an extracytosolic compartment; has similarity to human proteins involved in Menkes and Wilsons diseases
Sequence
MLLYMIVPMMWPTIVQDRIFPYKETSFVRGLFYRDILGVILASYIQFSVGFYFYKAAWAS
LKHGSGTMDTLVCVSTTCAYTFSVFSLVHNMFHPSSTGKLPRIVFDTSIMIISYISIGKY
LETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPAD
GIITRGESEIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYFRTTTVGEETKLANIIKV
MKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNISANPPVAFTANTKADNF
FICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDK
TGTLTTGFMVVKKFLKDSNWVGNVDEDEVLACIKATESISDHPVSKAIIRYCDGLNCNKA
LNAVVLESEYVLGKGIVSKCQVNGNAYDICIGNEALILEDALKKSGFINSNVDQGNTVSY
VSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENV
YSDVSPTGKCDLVKKNSR
Download sequence
Identical sequences YDR270W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]