SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER166W from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER166W
Domain Number 1 Region: 64-127,168-206
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.2e-17
Family Calcium ATPase, transduction domain A 0.0059
Further Details:      
 
Domain Number 2 Region: 210-333
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000471
Family Calcium ATPase, transmembrane domain M 0.034
Further Details:      
 
Domain Number 3 Region: 327-389
Classification Level Classification E-value
Superfamily HAD-like 0.0000103
Family Meta-cation ATPase, catalytic domain P 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YER166W
Sequence length 468
Comment DNF1 ORF Verified Aminophospholipid translocase (flippase) that localizes primarily to the plasma membrane; contributes to endocytosis, protein transport and cell polarity; type 4 P-type ATPase
Sequence
MQRKRHELRVQKTVGTSGPRSSLDSIDSYRVSADYGRPSLDYDNLEQGAGEANIVDRSLP
PRTDCKFAKNYWKXVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKV
RQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVL
LRGCTLRNTKWAMGVVMFTGDDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFV
SGIANGVYYDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKT
AQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTING
VSYGRAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTF
VSKEFVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKTRI
Download sequence
Identical sequences YER166W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]