SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR162C from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR162C
Domain Number 1 Region: 136-225,439-558
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.7e-20
Family Calcium ATPase, transmembrane domain M 0.031
Further Details:      
 
Domain Number 2 Region: 294-354,396-434
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000000589
Family Calcium ATPase, transduction domain A 0.0083
Further Details:      
 
Domain Number 3 Region: 552-587
Classification Level Classification E-value
Superfamily HAD-like 0.0000106
Family Meta-cation ATPase, catalytic domain P 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YMR162C
Sequence length 747
Comment DNF3 ORF Verified Aminophospholipid translocase (flippase) that maintains membrane lipid asymmetry in post-Golgi secretory vesicles; localizes to the trans-Golgi network; likely involved in protein transport; type 4 P-type ATPase
Sequence
MGIADGQRRRSSSLRTQMFNKHLYDKYRGRADDEIELEDINESKTFSGSDNNDKDDRDET
SGNYAAEEDYEMEEYGSPDVSYSIITKILDTILDRRRTFHSKDGRHIPIILDHNAIEYKQ
AATKRDGHLIDERFNKPYCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIP
GWSTTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVLVKDGNNDAQEVYT
LPSSVVSSTAYLTKSAAAENNPPLNDDRNSSQGHFLDTHFNNFELLKNKYNVHIHQKKWE
KLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKA
ASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNV
VGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKK
YIDQNKAWYLFQADAGIAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHA
ETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWLHNVDLGNSEDN
FEDNRDNTNSLRLPPKAHNGSSIDVVSIGDQNVLDRLGFSDAPIEKGHRPSLDNFPKSRN
SIEYKGNSSAIYTGRPSMISLFGKDNSHLSKQASVISPSETFSENIKSSFDLIQFIQRYP
TALFSQKAKFFFLSLALCHSCLPKKNS
Download sequence
Identical sequences YMR162C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]