SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YFR027W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR027W
Domain Number 1 Region: 138-235
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000667
Family N-acetyl transferase, NAT 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YFR027W
Sequence length 281
Comment ECO1 ORF Verified Acetyltransferase required for sister chromatid cohesion; modifies Smc3p at DNA replication forks during S-phase; modifies Mcd1p in response to double-strand DNA breaks during G2/M; mutations in human homolog ESCO2 cause Roberts syndrome
Sequence
MRARKSQRKAGSKPNLIQSKLQVNNGSKSNKIVKCDKCEMSYSSTSIEDRAIHEKYHTLQ
LHGRKWSPNWGSIVYTERYHSRTVHLSRSTGTITPLNSSPLKKSSPSITHQEEKIVYVRP
DKSNGEVRAMTEIMTLVNNELNAPHDENVIWNSTTEEKGKAFVYIRNDRAVGIIIIENLY
GGNGKTSSRGRWMVYDSRRLVQNVYPDFKIGISRIWVCRTARKLGIATKLIDVARENIVY
GEVIPRYQVAWSQPTDSGGKLASKYNGIMHKSGKLLLPVYI
Download sequence
Identical sequences C7GYD1
YFR027W YFR027W YFR027W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]