SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YHR013C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR013C
Domain Number 1 Region: 1-51,91-194
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.37e-20
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YHR013C
Sequence length 238
Comment ARD1 ORF Verified Subunit of N-terminal acetyltransferase NatA (Nat1p, Ard1p, Nat5p); acetylates many proteins and thus affects telomeric silencing, cell cycle, heat-shock resistance, mating, and sporulation; human Ard1p levels are elevated in cancer cells
Sequence
MPINIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDCEDSDEQ
DENDKLELTLDGTNDGRTIKLDPTYLAPGEKLVGYVLVKMNDDPDQQNEPPNGHITSLSV
MRTYRRMGIAENLMRQALFALREVHQAEYVSLHVRQSNRAALHLYRDTLAFEVLSIEKSY
YQDGEDAYAMKKVLKLEELQISNFTHRRLKENEEKLEDDLEGDLLEDIIKQGVNDIIV
Download sequence
Identical sequences A0A0L8VP48 B3LSD4 B5VJT8 C7GMP8 C8ZA80
YHR013C YHR013C SCRT_04720 YHR013C YHR013C YHR013C YHR013C YHR013C YHR013C YHR013C YHR013C YHR013C YHR013C YHR013C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]