SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR195C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR195C
Domain Number 1 Region: 219-455
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.74e-95
Family N-myristoyl transferase, NMT 0.000000000521
Further Details:      
 
Domain Number 2 Region: 35-218
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.84e-82
Family N-myristoyl transferase, NMT 0.00000000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLR195C
Sequence length 455
Comment NMT1 ORF Verified N-myristoyl transferase, catalyzes the cotranslational, covalent attachment of myristic acid to the N-terminal glycine residue of several proteins involved in cellular growth and signal transduction
Sequence
MSEEDKAKKLENLLKLLQLNNGDTSKFTQEQKKAMKDHKFWRTQPVKDFDEKVVEEGPID
KPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFF
NWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSK
RLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDG
HTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIG
EESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQ
FKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFL
NFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Download sequence
Identical sequences A0A0L8VL55 B5VNB5 C7GIS7 E7KG28 E7QI36
YLR195C YLR195C YLR195C YLR195C YLR195C YLR195C YLR195C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]