SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YNL132W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YNL132W
Domain Number - Region: 251-402
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0011
Family RNA helicase 0.094
Further Details:      
 
Domain Number - Region: 624-662
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0239
Family N-acetyl transferase, NAT 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YNL132W
Sequence length 1056
Comment KRE33 ORF Verified Essential protein, required for biogenesis of the small ribosomal subunit; heterozygous mutant shows haploinsufficiency in K1 killer toxin resistance
Sequence
MAKKAIDSRIPSLIRNGVQTKQRSIFVIVGDRARNQLPNLHYLMMSADLKMNKSVLWAYK
KKLLGFTSHRKKRENKIKKEIKRGTREVNEMDPFESFISNQNIRYVYYKESEKILGNTYG
MCILQDFEALTPNLLARTIETVEGGGIVVILLKSMSSLKQLYTMTMDVHARYRTEAHGDV
VARFNERFILSLGSNPNCLVVDDELNVLPLSGAKNVKPLPPKEDDELPPKQLELQELKES
LEDVQPAGSLVSLSKTVNQAHAILSFIDAISEKTLNFTVALTAGRGRGKSAALGISIAAA
VSHGYSNIFVTSPSPENLKTLFEFIFKGFDALGYQEHIDYDIIQSTNPDFNKAIVRVDIK
RDHRQTIQYIVPQDHQVLGQAELVVIDEAAAIPLPIVKNLLGPYLVFMASTINGYEGTGR
SLSLKLIQQLRNQNNTSGRESTQTAVVSRDNKEKDSHLHSQSRQLREISLDEPIRYAPGD
PIEKWLNKLLCLDVTLIKNPRFATRGTPHPSQCNLFVVNRDTLFSYHPVSENFLEKMMAL
YVSSHYKNSPNDLQLMSDAPAHKLFVLLPPIDPKDGGRIPDPLCVIQIALEGEISKESVR
NSLSRGQRAGGDLIPWLISQQFQDEEFASLSGARIVRIATNPEYASMGYGSRAIELLRDY
FEGKFTDMSEDVRPKDYSIKRVSDKELAKTNLLKDDVKLRDAKTLPPLLLKLSEQPPHYL
HYLGVSYGLTQSLHKFWKNNSFVPVYLRQTANDLTGEHTCVMLNVLEGRESNWLVEFAKD
FRKRFLSLLSYDFHKFTAVQALSVIESSKKAQDLSDDEKHDNKELTRTHLDDIFSPFDLK
RLDSYSNNLLDYHVIVDMIPMLALLYFGDKMGDSVKLSSVQSAILLAIGLQRKNIDTIAK
ELNLPSNQTIAMFAKIMRKMSQYFRQLLSQSIEETLPNIKDDAIAEMDGEEIKNYNAAEA
LDQMEEDLEEAGSEAVQAMREKQKELINSLNLDKYAINDNSEEWAESQKSLEIAAKAKGV
VSLKTGKKRTTEKAEDIYRQEMKAMKKPRKSKKAAN
Download sequence
Identical sequences A6ZRV1 B5VQR6 C7GKB4 C8ZG98 G2WLX4 N1P4B1
YNL132W YNL132W YNL132W YNL132W tr|A6ZRV1|A6ZRV1_YEAS7 YNL132W YNL132W YNL132W YNL132W YNL132W YNL132W YNL132W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]