SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPL001W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL001W
Domain Number 1 Region: 6-320
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.6e-117
Family N-acetyl transferase, NAT 0.0000000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPL001W
Sequence length 374
Comment HAT1 ORF Verified Catalytic subunit of the Hat1p-Hat2p histone acetyltransferase complex that uses the cofactor acetyl coenzyme A, to acetylate free nuclear and cytoplasmic histone H4; involved in telomeric silencing and DNA double-strand break repair
Sequence
MSANDFKPETWTSSANEALRVSIVGENAIQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDS
VTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDV
FEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLL
NKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAII
QSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSL
KLEERQFNRLVEMLLLLNNSPSFELKVKNRLYIKNYDALDQTDPEKAREALQNSFILVKD
DYRRIIESINKSQG
Download sequence
Identical sequences C7GV46 C8ZJ25
YPL001W YPL001W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]