SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPR051W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR051W
Domain Number 1 Region: 13-159
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.09e-27
Family N-acetyl transferase, NAT 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YPR051W
Sequence length 176
Comment MAK3 ORF Verified Catalytic subunit of N-terminal acetyltransferase of the NatC type; required for replication of dsRNA virus
Sequence
MEIVYKPLDIRNEEQFASIKKLIDADLSEPYSIYVYRYFLNQWPELTYIAVDNKSGTPNI
PIGCIVCKMDPHRNVRLRGYIGMLAVESTYRGHGIAKKLVEIAIDKMQREHCDEIMLETE
VENSAALNLYEGMGFIRMKRMFRYYLNEGDAFKLILPLTERSCTRSTFLMHGRLAT
Download sequence
Identical sequences A0A250WDH2 A6ZWU1 B3LLA7 B5VTK4 C7GY39 C8ZJ76 E7KJI6 E7KV00 E7M1P4 E7NNX7 E7QAG6 E7QLU3 G2WPM6 H0GPX9
YPR051W YPR051W YPR051W YPR051W YPR051W YPR051W YPR051W YPR051W tr|A6ZWU1|A6ZWU1_YEAS7 YPR051W YPR051W YPR051W YPR051W SCRT_02538 YPR051W YPR051W YPR051W YPR051W YPR051W YPR051W YPR051W YPR051W YPR051W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]