SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPR193C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR193C
Domain Number 1 Region: 9-146
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.91e-24
Family N-acetyl transferase, NAT 0.000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YPR193C
Sequence length 156
Comment HPA2 ORF Verified Tetrameric histone acetyltransferase with similarity to Gcn5p, Hat1p, Elp3p, and Hpa3p; acetylates histones H3 and H4 in vitro and exhibits autoacetylation activity
Sequence
MSNTSEDNITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAV
AVESSSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLG
TPSVYWCTDESNHRAQLLYVMVGYKAPKILYKRKGY
Download sequence
Identical sequences A0A0L8VH74 B3LKF1 C7GP74 E7QM31
YPR193C YPR193C YPR193C SCRT_02666 YPR193C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]