SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR328C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR328C
Domain Number 1 Region: 134-192
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.81e-44
Family Skp1 dimerisation domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 6-33,66-99
Classification Level Classification E-value
Superfamily POZ domain 2.93e-22
Family BTB/POZ domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR328C
Sequence length 194
Comment SKP1 ORF Verified Evolutionarily conserved kinetochore protein that is part of multiple protein complexes, including the SCF ubiquitin ligase complex, the CBF3 complex that binds centromeric DNA, and the RAVE complex that regulates assembly of the V-ATPase
Sequence
MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSK
DNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWD
REFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEE
EAAIRRENEWAEDR
Download sequence
Identical sequences A0A0L8VTS7 A0A250W893 A6ZYT0 B3LFW9 B5VGL0 C7GWM5 C8Z5P1 E7KAV5 E7KM00 E7LSU0 E7NG32 E7Q2K2 E7QD84 G2WB67 H0GEF6 N1P6Y0 P52286
YDR328C YDR328C YDR328C YDR328C tr|A6ZYT0|A6ZYT0_YEAS7 YDR328C YDR328C YDR328C YDR328C YDR328C YDR328C YDR328C 4932.YDR328C NP_010615.3.97178 YDR328C YDR328C YDR328C SCRT_00201 YDR328C YT19 YDR328C YDR328C YDR328C YDR328C YDR328C YDR328C 6f07_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]