SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKL133C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YKL133C
Domain Number - Region: 98-162
Classification Level Classification E-value
Superfamily TPR-like 0.00136
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YKL133C
Sequence length 463
Comment ORF Uncharacterized Putative protein of unknown function; has similarity to Mgr3p, but unlike MGR3, is not required for growth of cells lacking the mitochondrial genome (null mutation does not confer a petite-negative phenotype)
Sequence
MWKYLHRSVKNEGXVERLTNLNLFTNHRFKFYSTLKEQSFWRIPFKRRSKLQKWVLSTGI
VSFIAFNIWWVYWPHHTFPKPVAKILRKGLHSEIKKEGANYQKSLEYYLEALEECKAENV
DLLSDEYTGIEIKIGEMYEKLHMYNDATALYGDMLKKFYNELSKTTDKSTKRKFFLLKRD
LQILVRFNEINKDSETNATLLIMHLLLAQREFLENSPEFKNVLSKSELLNNQQLDWKNFK
GLPFIGKSKPDYQMHLNSKRKQELKIKEPESEQCVFMKELLTARDLYTRYCLNRSNLSGA
LNSKITTLEWMLLADSPLDDILLAQAELGSIFYLNSEKFEGSLYAIDNEPYKKSEPLELI
RSRLQENQNSCLQYSADCYKSIISFANENQYPKVAMESEMDQRILKALSLAHYGIGVINL
HKGRLRASKKELKKAIRISEMIRFNELIEEAQRELKKVDGTPI
Download sequence
Identical sequences E7KQX8
YKL133C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]