SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549683741|ref|YP_008657782.1| from Blattabacterium sp. (Nauphoeta cinerea)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549683741|ref|YP_008657782.1|
Domain Number 1 Region: 93-281
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.14e-49
Family B3/B4 domain of PheRS, PheT 0.0000699
Further Details:      
 
Domain Number 2 Region: 586-684
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 6.15e-22
Family Anticodon-binding domain of PheRS 0.0016
Further Details:      
 
Domain Number 3 Region: 361-576
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.46e-21
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0018
Further Details:      
 
Domain Number 4 Region: 298-369
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000247
Family Domains B1 and B5 of PheRS-beta, PheT 0.0081
Further Details:      
 
Domain Number 5 Region: 1-71
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000114
Family Domains B1 and B5 of PheRS-beta, PheT 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549683741|ref|YP_008657782.1|
Sequence length 686
Comment Phenylalanyl-tRNA synthetase beta chain [Blattabacterium sp. (Nauphoeta cinerea)]
Sequence
MKISLNWLKKYVFPLDIEENKISNILTDIGLTVKGINNIDKDLVLDVEITPNRTDAMSHY
GIARDLYAVLKFRGYKVNLLKPVINKGIHYNTKPHIQVFVKIHEKCIRYSGMFIYKIKIE
PSPYWLISRLKSIGIKSINNIIDTMHFVMYELGQPIHIFDMDQIENGKIIITNADKNTNF
QSSDNVTIKLDEEDLIICDAMKPLSIAGMINHVESNINIRTKNIFIGSACFNPIIIRNFI
KKHSIKIKAQHLFEKDTDPNQTIYALQRIAFLIKNIMKNNVSCSDIIDFYPNPISFSKIK
LRYQKIINIIGKKISIKKIKKILSLLEITIHSENNKCLFISVPSYRTDVQREIDVIEEIL
RIYGIHKIPIYHQIKTPFIFPKVFYKTEYEIQKIFSEQLTCYGFQEIISSTMTNEKKYSC
LLNSFFHRKGIQVINPVNQTYKVMRSSLLFSIIDCIKYNYNNNRINSSIKFFELGKIYYK
INNKFLEKSYLGMAISQKEKIKSQNSPFFYLKGIIEQIFQKSGIYNYTQILSEHPLLENG
ISILYDHKNLVELGKFKNNVLKKNEIFYAEIDWRYLVSIIQEKKIIYIPFSKYPSSRRDL
CLLVDKTISFEKINQIVKKKENHIIKKIQIYDLYEGINLPISKKSYTISFFFESQKETLT
DKIISDSMKEIELFLKQELKAEIREK
Download sequence
Identical sequences U3QCK0
gi|549683741|ref|YP_008657782.1| WP_022564880.1.57823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]