SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for symbB.v1.2.025598.t1|scaffold2482.1|size80432|4 from Symbiodinium minutum clade B1 v1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  symbB.v1.2.025598.t1|scaffold2482.1|size80432|4
Domain Number - Region: 153-197
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) symbB.v1.2.025598.t1|scaffold2482.1|size80432|4
Sequence length 213
Sequence
MRQELESRDHYPSSNPWDSRDKDPMELYNLLAEKRKELQQLQRVSEGLEHAAEVQRKAES
EQSFVRPEIEERLQKAKLEVEQQKRLNVKLQSDRLKLSNQRKAVEEDLRKVGSELRSKGA
LLHRKGLPAGEKGGHSILEQLRREVDILRGALKQDERKHRAMLKEDSQEVDFAAAHVQSL
EKAIEEREAQISKLRSALGNPRERVQGAEAGAH
Download sequence
Identical sequences symbB.v1.2.025598.t1|scaffold2482.1|size80432|4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]