SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for symbB.v1.2.002754.t1|scaffold141.1|size300911|5 from Symbiodinium minutum clade B1 v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  symbB.v1.2.002754.t1|scaffold141.1|size300911|5
Domain Number 1 Region: 428-620
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.64e-31
Family cAMP-binding domain 0.00053
Further Details:      
 
Domain Number 2 Region: 314-446
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-17
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) symbB.v1.2.002754.t1|scaffold141.1|size300911|5
Sequence length 871
Sequence
MAASTRSKRLSVQVVPGPDHDDDDDADPPENPEKVKSKEANLNVVNAGSEASPPRTPRAL
KANQSETKNDISTLISRKSFANVQFHRYSVFASLFDLRAAVSKLLDRHGKYKYDDAAPDE
DEPRIRRCLHCLVATIRATARQEVRMHPLCFLSLLIGPFMLSFETTCSEVERPMVLTAKI
IHLVSTVAYLFFAAAHFLYSPLNPWPEILKQRRKRFKLLSHKAEVLHPALVQQLHARGGP
EEETNHEATKNPLTSLRFWVPIFDGLVLLGFVAEIVNMTKRPSRIEGWSHWAWILVTARG
FRLVVPPSDIVVSNFWTDTLVLGMWLFVVIHLCSCLLSVVSVLEVQNGNVQAWAAEQLLD
SGGSSCRRFYMYSWYYTSTTVTSIGYGDISPQNPDERLVASAVMILSQLYFAKVFADLTF
LTSMYNQWTLQRHQRMTQTRSALESMNIPKTLIQRVQACQTYVWDMQKERRAKNCFEDLT
SQLQEEVKLVLYSRLVMQVPFLQTLDARALRFLIGRLSDQVFLPADFIICRGDIGNEMYF
LREGFAGVFTCQRAPHWEDDEIKKVEKGSHFGEIALLTGQLRTAWIMARAYCLTSVLQAS
AIDNLMAQDPTSICTLIKNFQDMLKLKPSLSWSDIKTRLDREFDPDDPCRHDLYDFVCSG
DDGLAPAGMTMRVRREPCLSSLALLPGIITWTRYQVLLSRIQVSQLDQKLLWAELDEEQS
GAVTFYNFVLTVYLKAPEESDPEDDDDPFRPSASRPMGSTSLRSSKSAKSLRPGGSSGEI
IRKDSTCSQHSSRSKMPLQFRSRSMYRNKKKGAASDVDSAMLNRLMVLEDKIDVLLNSVP
GGHSMVLDSQRLHSGRPSVEVTPPPMEVLLS
Download sequence
Identical sequences symbB.v1.2.002754.t1|scaffold141.1|size300911|5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]