SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for symbB.v1.2.004403.t2|scaffold247.1|size253962|3 from Symbiodinium minutum clade B1 v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  symbB.v1.2.004403.t2|scaffold247.1|size253962|3
Domain Number 1 Region: 547-584,617-694,797-845
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.9e-16
Family Protein kinases, catalytic subunit 0.051
Further Details:      
 
Domain Number 2 Region: 85-249
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 0.0000000000181
Family NagB-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) symbB.v1.2.004403.t2|scaffold247.1|size253962|3
Sequence length 978
Sequence
MLPSIAAGPLPTLPIFGPKLRISRIPEAPVKPGYRCPSINARHWASVATVATISVKQGLR
KSSSSRVIRAADPGSEFTVDGRGTVIVLPNEDEVLEAIAEETASCACTAIEEKGAFSICV
PGSFGPADGKAFAGAQLIAKSLSILSQEDLQFDKWHVFFAGERLDSQESFLLAKQWIDQS
QIPSSQVHPIPQLPGAAEGAAAQYTAEICMQDESVLMDSDQGLPAVDLLLLDMAPDGTVG
RLRPDSRSHVVPSVEPDLEDVDVEGFTPLPVVNKRAPVPLATRSPPGSSSSPTRRFPHLW
KLIIAILMLHCTLQLRFLLPAPKTALARLLMWPVRAIYTAESTAVLFAPALCWLTIVAWQ
SLQLPQQEGSAAGQRIRKILETSLWISLALLAVTAIFDGDALLRSVTLFLYFPAASIWLA
SHSERGRSFRRLASTWLVFLPLIFEYKLMSWWLRFASLDATQGSYFAHLHEKYAPRVLRL
LVKQGGIFVKIGQMLSLLPTGVLPEPYLREFKTLQSRVPPRPGPEVKALISEALGQPIES
VFTRFDEVPIGSASIGQVHRATLAVSGLEVVVKVQYPEVSQTIEADFANCERIVWLLDKS
KMDEVRDAKTHHQEELDFQKEASNLLRVRVGLCKRFPEVEVPEPILEFCRPTVLVMTHLA
GHSLLDAIMDMAEAIAKMRGKSVEDLIAEFTPSSGKDKANEQDEGTEDLVLKQDSGKLTP
KSEKASRSRKKWPRLGAVGSFMPSLPSIPDTAKIKLLQLCMSTSRSARNFGVALYNSSAG
RFGANKLEYSRSLCCFDPKEMSYKLWSIHGHQVLVDGLFSTDPHPGNILVSPGGQVGLID
FGQVYEMKLQHRVFFAHLLLALAADDDEEIAYWYQQLGMTSRHGSVELLALNAKVKFGHA
SILSKETYERYRKLAAQDSLSNEKNSCIGRVERLVQILRGTSFLLGVPNAHGPTTLWVEI
ARKLLGERMPQLDMAEAF
Download sequence
Identical sequences symbB.v1.2.004403.t2|scaffold247.1|size253962|3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]