SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for symbB.v1.2.007117.t1|scaffold430.1|size206084|12 from Symbiodinium minutum clade B1 v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  symbB.v1.2.007117.t1|scaffold430.1|size206084|12
Domain Number 1 Region: 252-458
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000327
Family Tropomyosin 0.002
Further Details:      
 
Domain Number 2 Region: 86-231
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000752
Family Tropomyosin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) symbB.v1.2.007117.t1|scaffold430.1|size206084|12
Sequence length 602
Sequence
MEELEKRLAAIEKAMEEEAAGGAPRKAGSDAQVMKKVATRLQDFESQITAQLSNLQTDFD
KKLSHVNRGASSTKPVDGAGGAAGLDTMAEDLDQLKYDVGELKDLLGNNKGEVNHIRRIV
LACERDMEDFTAAMDAVNVDLDEMRARVDATHSIITSRQRVEATMTAEISTMRLDIGDIQ
EALKNHDSWMEDVSNTLQQMQEKEENLTEDIINLKNEMNTKLDTKVDNVAWKEANDDLDA
AVKTVRDMVSSLRLDVDARRRKVDEILATVRHDITAVETNLEESKAKITSDTDQAVNALN
GRIDFTNKDLAATQESLHTTQNSLSDCFNEVAVVRSDLERNVADTEARLKNDIRQKQQEA
FEKIGAVEQQAELRSAEASRRLGALDLRMSGVQGGLGEHKRDILKLREEVNGLTVKSASH
EVDIQKTSDAVRKMEKQRNMDEQNWKAQMDAVHDVLDTKVNEKPFEDLKHCTAALTRGVV
KFAQVVGVFPGPKFDDAEGADQGEADVELLGWEECAENMSFRVDKAWRQRCSQRFRNILD
MVAKKADHSVLRLLQISQQHIESQLERVKHERELWKEVVERRQQQPLQLALSMKEQTAGP
GQ
Download sequence
Identical sequences symbB.v1.2.007117.t1|scaffold430.1|size206084|12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]