SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for symbB.v1.2.012718.t1|scaffold883.1|size155361|3 from Symbiodinium minutum clade B1 v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  symbB.v1.2.012718.t1|scaffold883.1|size155361|3
Domain Number 1 Region: 1-371
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 9.77e-103
Family IF2B-like 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) symbB.v1.2.012718.t1|scaffold883.1|size155361|3
Sequence length 382
Sequence
MRVDGKWYRTIWLKDADASVVQIIDQRHLPHDFVVEDIKTVEEMCVAIKDMHVRGAGLIG
CAAAYGMYLAIATGPTASGRSVAEVTALVANAAQRLLQTRPTAVNLRVGVEKLQQLMELQ
LKTVEGTLSAEVAEALICAARQEANRITDEDAEFCRRIGEAGADVLQEIYDRKQATLQVL
THCNAGWLAFADWGSALSPVYVAFDRGLPIHVWVDETRPRNQGASLTAWELAKHGVKHTV
IADNAGGHLMRIKQVDLVITGADRVTRGGDVCNKIGTYLKALAAKDNDVPFYVALPSSTI
DWRMKDGAEIPIEQRGDEEVKYAEGLCDDGKRRKVLLTPATSSAGNWAFDVTPARLITGL
LTERGLSASSEESLLKKFPEVS
Download sequence
Identical sequences symbB.v1.2.012718.t1|scaffold883.1|size155361|3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]