SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for symbB.v1.2.013793.t1|scaffold985.1|size202120|4 from Symbiodinium minutum clade B1 v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  symbB.v1.2.013793.t1|scaffold985.1|size202120|4
Domain Number 1 Region: 7-195
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.35e-20
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 
Domain Number 2 Region: 764-950
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.15e-16
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 3 Region: 559-758
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000243
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) symbB.v1.2.013793.t1|scaffold985.1|size202120|4
Sequence length 1041
Sequence
MGRETGTLILGSMAFNFSMGVTEGPEVVFFKDYFGFSQNDMSDLLLVSCLAALVLTPFLP
ALQTRLGERESCVVGCCGIACTTFTLIMGTGHKFVPLVTAGLSVGLFGSMTGLGFMAMVN
SCCPKDRLGTFLGIKSFFDSLSGTLSPAFGGWLYTRDHFLPYGLSVGLLAATAGVFASFA
PLQEKPKPKAINKEEVEPMLGKELETDSDEADMGPTPSLTTENLPFSKNTMMLKLVTNEL
GILMDEQLGNFFYSKNNFKAGGIRRSATIGVENFIAAADGKTPLRARQLRGASTKPELPD
TDTSMMRGLEAGQVHEAQLNAAEERLKEATVELQQLRLSLAPSAPSDAAGADGTPMSPTT
RRELEAPRPPTSPPKLTVQVGDRGAKRLGSRVSFSYDENGGDSPDRSPRGHAETMNSQNT
EGDHPEDSGIVGDPSPRAWSTPLPLPGLVPPDGGPRRASVDGGTVPFSAVMPGENNEGQN
SAGPGLPRALSRITGDTEMMRFREELPPDLKLAAAWRKKTSGTTSKVGRTVSSKAHMHMD
TEEEELLLLRVLDRMVLDPSSAKRMAFEVFGLVLIIYDLFWLPMQVFDPPVSTFTEVMGW
TSSIYWLVDIPMSFLVGNIRKGIMEIKVRTIAGIYLRGWFWFDILVVSVDWVLNILEVVN
NTKNVGGISALRLGKGVRVLRVFRLIRVLKGGGILQELLDTIHSEHCIIIVGIVKLLGLI
LCVYPTNEEERIFCVCVIVSAMVIFSSFISAITNAMTQLRNLNREKIEQFSLLRKYLTQC
NVSGGLLARVLQSVSSALNKNKRRVHEEDIKVLHLLPLSLRQDINQEVYSPYFVAHPFFS
VCSSCFDAYVRKLYSSGVKGKFLPANQELITSGEQAKEMLFVISGTVNYKADRQVSPLPV
PMVEGTWLSEACLWIHWSHNGIGTTAQECDVLALDASKFQDVFKDDVTVKHYAVAFWSHF
MANPMHLTDIWSDEEFLYQWSTESLLTAEQCVGSAIQPDQRNSEFYRYVTTKRRSSSAML
DQTLLGKDFFSSAAELGLDSP
Download sequence
Identical sequences symbB.v1.2.013793.t1|scaffold985.1|size202120|4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]