SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDL046W from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL046W
Domain Number 1 Region: 41-171
Classification Level Classification E-value
Superfamily E set domains 3.73e-22
Family ML domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDL046W
Sequence length 173
Comment NPC2 ORF Verified Functional homolog of human NPC2/He1, which is a cholesterol-binding protein whose deficiency causes Niemann-Pick type C2 disease involving retention of cholesterol in lysosomes
Sequence
MTHGLKALFALLFLYTAAVNAGVIGIFNALPPPNTKPINGESPLYQCDILDKQLVEIKEV
NLDPNPPVRGENLTISANGEVFETIEEGAYIDVEVRLGYIRLLSQTFDLCETLEDNDIEG
LSCPIEPGEYNIKKIVEIPGEVPPGKYVVVARAYTEKDDLITCLTGEVIFPPR
Download sequence
Identical sequences A6ZXS8 G2WCB4
tr|A6ZXS8|A6ZXS8_YEAS7 YDL046W YDL046W YDL046W YDL046W YDL046W YDL046W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]