SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDL135C from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL135C
Domain Number 1 Region: 8-202
Classification Level Classification E-value
Superfamily E set domains 1.96e-61
Family RhoGDI-like 0.0000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDL135C
Sequence length 202
Comment RDI1 ORF Verified Rho GDP dissociation inhibitor involved in the localization and regulation of Cdc42p
Sequence
MAEESTDFSQFEEERNNDQYKVSAKKTVDEYKNLDAEDESLAKWKESLGLSSDVLPLEFP
GDKRKVVVQKIQLLVNTEPNPITFDLTNEKTIKELASKRYKIKENSIYKLKIVFKVQHEI
ITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTKTKPFYEVELPESEAPSGFLARGNYSAVS
KFIDDDKTNHLTLNWGVEIVKK
Download sequence
Identical sequences A0A0L8VSD6 A6ZXJ2 B3LH27 B5VFD5 C7GST0 C8Z6G7 E7KLD4 E7LSC1 E7Q1S3 E7QCF2 N1PAM8 Q12434
YDL135C YDL135C YDL135C YDL135C YDL135c___KOG3205 YDL135C NP_010146.1.97178 YDL135C YDL135C 4932.YDL135C YDL135C YDL135C YDL135C YDL135C YDL135C tr|A6ZXJ2|A6ZXJ2_YEAS7 SCRT_00631 YDL135C YDL135C YDL135C YDL135C YDL135C YDL135C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]