SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER027C from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER027C
Domain Number 1 Region: 313-416
Classification Level Classification E-value
Superfamily AMPKBI-like 1.01e-29
Family AMPKBI-like 0.00000426
Further Details:      
 
Domain Number 2 Region: 162-243
Classification Level Classification E-value
Superfamily E set domains 6.53e-22
Family AMPK-beta glycogen binding domain-like 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YER027C
Sequence length 417
Comment GAL83 ORF Verified One of three possible beta-subunits of the Snf1 kinase complex, allows nuclear localization of the Snf1 kinase complex in the presence of a nonfermentable carbon source; contains glycogen-binding domain
Sequence
MAGDNPENKDASMLDVSDAASNTTINGKHSADSTNEASLAYTFSQMNVDNPNELEPQHPL
RHKSSLIFNDDDDDEIPPYSNHAENGSGETFDSDDDIDASSSSSIDSNEGDIHDADMTGN
TLQKMDYQPSQQPDSLQNQGFQQQQEQQQGTVEGKKGRVMMFPVDITWQQGGNKVYVTGS
FTGWRKMIGLVPVPGQPGLMHVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNY
MEVSAPPDWGNEPQQHLAEKKANHVDDSKSSKRPMSARSRIALEIEKEPDDMGDGYTRFH
DETPAKPNLEYTQDIPAVFTDPNVMEQYYLTLDQQQNNHQNMAWLTPPQLPPHLENVILN
SYSNAQTDNTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPLQ
Download sequence
Identical sequences YER027C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]