SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YFR022W from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YFR022W
Domain Number - Region: 43-118,151-215
Classification Level Classification E-value
Superfamily E set domains 0.00175
Family Arrestin/Vps26-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YFR022W
Sequence length 733
Comment ROG3 ORF Verified Protein that binds the ubiquitin ligase Rsp5p via its 2 PY motifs; has similarity to Rod1p; mutation suppresses the temperature sensitivity of an mck1 rim11 double mutant; proposed to regulate the endocytosis of plasma membrane proteins
Sequence
MGFSSGKSTKKKPLLFDIRLKNVDNDVILLKGPPNEAPSVLLSGCIVLSINEPMQIKSIS
LRLYGKIQIDVLLERPQDASSSSLSSSPPKIRKYNKVFYNYAWDNVNLKEYLSGLRGQSG
LAGSSSSSNILGTRQRAQSTSSLKSLKGSSSPSSCTLDKGNYDFPFSAILPGSLPESVES
LPNCFVTYSMESVIERSKSYSDLICRKNIRVLRTISPAAVELSETVCVDNSWPDKVDYSI
SVPNKAVAIGSATPINISIVPLSKGLKLGSIKVVLFENYQYCDPFPPVISENRQVTELNL
EDPLNESSGEFNGNGCFVNNPFFQPDHSFQDKWEIDTILQIPNSLSNCVQDCDVRSNIKV
RHKLKFFIILINPDGHKSELRASLPIQLFISPFVALSIKPLSSSNLYSLFSTTNQKDENS
SQEEEEEYLFSRSASVTGLELLADMRSGGSVPTISDLMTPPNYEMHVYDRLYSGSFTRTA
VETSGTCTPLGSECSTVEDQQQDLEDLRIRLTKIRNQRDNLGLPPSASSAAASRSLSPLL
NVPAPEDGTERILPQSALGPNSGSVPGVHSNVSPVLLSRSPAPSVSAHEVLPVPSGLNYP
ETQNLNKVPSYGKAMKYDIIGEDLPPSYPCAIQNVQPRKPSRVHSRNSSTTLSSSIPTSF
HSSSFMSSTASPISIINGSRSSSSGVSLNTLNELTSKTSNNPSSNSMKRSPTRRRATSLA
GFMGGFLSKGNKR
Download sequence
Identical sequences YFR022W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]