SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGL208W from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL208W
Domain Number 1 Region: 307-412
Classification Level Classification E-value
Superfamily AMPKBI-like 4.32e-33
Family AMPKBI-like 0.000000722
Further Details:      
 
Domain Number 2 Region: 163-246
Classification Level Classification E-value
Superfamily E set domains 1.47e-23
Family AMPK-beta glycogen binding domain-like 0.00000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YGL208W
Sequence length 415
Comment SIP2 ORF Verified One of three beta subunits of the Snf1 serine/threonine protein kinase complex involved in the response to glucose starvation; null mutants exhibit accelerated aging; N-myristoylprotein localized to the cytoplasm and the plasma membrane
Sequence
MGTTTSHPAQKKQTTKKCRAPIMSGVRENPSNAQGCEPQEMDAVSKKVTELSLNKCSGSQ
GAVQPSREGSITKKKSTLLLRDEDEPTMPKLSVMETAVDTDFGSSSTSDDEEGDIIAQTT
EPKQDASPDDDRSGHSSPREEGQQQIRAKEASGGPSEIKSSLMVPVEIRWQQGGSKVYVT
GSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRISDFLPTATDQMGNFV
NYIEVRQPEKKPTNEKIRSKEAYSMRPPTSNRSSIALQIGKDPDDFGDGYTRFHEDLSPR
PPLEYTTDIPAVFTDPSVIERYYYTLDRQQSNTDTSWLTPPQLPPQLENVILNKYYATQD
QFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIESS
Download sequence
Identical sequences YGL208W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]