SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YIL024C from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL024C
Domain Number 1 Region: 16-93
Classification Level Classification E-value
Superfamily E set domains 0.0000000000056
Family AMPK-beta glycogen binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YIL024C
Sequence length 189
Comment ORF Uncharacterized Putative protein of unknown function; non-essential gene; expression directly regulated by the metabolic and meiotic transcriptional regulator Ume6p
Sequence
MSNFLLVIPEDVIKGCSKADKLVVTGEFDNWRHSDYVLQYDGSTQNYRVQIPRRKGQRST
MFKVVINDKKWVTLNYFDTVTDKSGYTNNILHFKDNEASQLMDIPLSPHTRSNTAKGKPE
DDSLNDYVNLSSHSDLSSTEEIVCWNSDMEDENMDATIQCDFHQAFNSRKESLNGLMCIA
KKVKTYWNK
Download sequence
Identical sequences A0A250WMN4 G2WGC0 N1P958 P40543
YIL024C YIL024C YIL024C YIL024C YIL024C NP_012240.3.97178 YIL024C YIL024C YIL024C YT512 YIL024C 4932.YIL024C YIL024C YIL024C YIL024C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]