SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKR021W from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YKR021W
Domain Number - Region: 265-335
Classification Level Classification E-value
Superfamily E set domains 0.014
Family Arrestin/Vps26-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YKR021W
Sequence length 915
Comment ALY1 ORF Verified Protein proposed to regulate the endocytosis of plasma membrane proteins by recruiting the ubiquitin ligase Rsp5p to its target in the plasma membrane; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm
Sequence
MLQFNTENDTVAPVFPMEQDINAAPDAVPLVQTTTLQVFVKLAEPIVFLKGFETNGLSEI
APSILRGSLIVRVLKPNKLKSISITFKGISRTEWPEGIPPKREEFSDVETVVNHTWPFYQ
ADDGMNSFTLEHHSSNNSSNRPSMSDEDYLLEKSGASVYIPPTAEPPKDNSNLSLDAYER
NSLSSDNLSNKPVSSDVSHDDSKLLAIQKTPLPSSSRRGSVPANFHGNSLSPHTFISDLF
TKTFSNSGATPSPEQEDNYLTPSKDSKEVFIFRPGDYIYTFEQPISQSYPESIKANFGSV
EYKLSIDIERFGAFKSTIHTQLPIKVVRLPSDGSVEETEAIAISKDWKDLLHYDVVIFSK
EIVLNAFLPIDFHFAPLDKVTLHRIRIYLTESMEYTCNSNGNHEKARRLEPTKKFLLAEH
NGPKLPHIPAGSNPLKAKNRGNILLDEKSGDLVNKDFQFEVFVPSKFTNSIRLHPDTNYD
KIKAHHWIKICLRLSKKYGDNRKHFEISIDSPIHILNQLCSHANTLLPSYESHFQYCDED
GNFAPAADQQNYASHHDSNIFFPKEVLSSPVLSPNVQKMNIRIPSDLPVVRNRAESVKKS
KSGNTSKKNDQSSNVFASKQLVANIYKPNQIPRELTSPQALPLSPITSPILNYQPLSNSP
PPDFDFDLAKRGAADSHAIPVDPPSYFDVLKADGIDLPYYDTSSSKIPELKLNKSRETLA
SIEEDSFNGWSQIDDLSDEDDNDGDIASGFNFKLSTSAPSENVNSHTPILQSLNMSLDGR
KKNRASLHATSVLPSTIRQNNQHFNDINQMLGSSDEDAFPKSQSLNFNKKLPILKINDNV
IQSNSNSNNRVDNPEDTVDSSVDITAFYDPRMSSDSKFDWEVSKNHVDPAAYSVNVASEN
RVLDDFKKAFREKRK
Download sequence
Identical sequences YKR021W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]