SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR392C from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YLR392C
Domain Number - Region: 14-115
Classification Level Classification E-value
Superfamily E set domains 0.098
Family Arrestin/Vps26-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YLR392C
Sequence length 518
Comment ART10 ORF Verified Protein of unknown function that contains 2 PY motifs and is ubiquinated by Rsp5p; green fluorescent protein (GFP)-fusion protein localizes it to the cytoplasm; non-essential gene
Sequence
MAPKISISLNPPYNGEFYSSNDQMSGIVSLQLTKALSIRKISVILKGFSETLTKIDQEYM
FQQNGMMMPGQDNKSFHTLMKFEQRVFPPDNVWNALDGSSKPFKVKPGSYNYSFQFDKFP
RKPECLKNHTAKTVAFVTRSNARLPPTFNSHWQEFNKIDNLDLYFYSFGKVIYMVQVQIE
LGKSSSWFKPFHKLIREIETFEFIPEPKDLIIEPDEDDNEELNAFSNNSRGNSMVTNNEF
FNSSNLKVPSKDVKVVNGVGYIKSDRNFSQANSILIENGDIRSRPVSSVTSTRQSTRLVN
GMKVFPSTYKMGLPDGESNMRIEVRSRDLKQIYRKDYLFRSGSQNFDKVYVVMEGNIASL
SKMQITPLKLQLNLLETTTYLSQGIANGNYSSLKLIEIDLNQLKSNKPLLDLNEIRENFD
GSMFECELRLKDHPILRKLVFNEEDYRHRGNRLYSFKTCTIKRIFSLQLLIEWGINGIRK
QSEVNIDPVQIFCQVREHVEAEALPRYVPPPTYTEMAS
Download sequence
Identical sequences A7A1R7 E7NL22 E7Q7B2
YLR392C YLR392C YLR392C tr|A7A1R7|A7A1R7_YEAS7 YLR392C YLR392C YLR392C YLR392C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]