SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YNL173C from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL173C
Domain Number 1 Region: 7-86
Classification Level Classification E-value
Superfamily E set domains 4.6e-16
Family AMPK-beta glycogen binding domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YNL173C
Sequence length 366
Comment MDG1 ORF Verified Plasma membrane protein involved in G-protein mediated pheromone signaling pathway; overproduction suppresses bem1 mutations
Sequence
MQSSLPQFTFKWPKGPEAVILTGTFDDWKGTLPMVKDPSGAFEITLPVTFDSPSSKFYFK
FIVDGQWLPNKDYKVNIDEGVENNFITEEDVIKQRENGSSTLVPESAGLAVSKNAPLIEP
EAEKRAKKLRKFKIKRVIKTNKQTGERSIFSQEVVELPDSEDETQQVNKTGKNADGLSGT
TTIMENNVGVNEEKAIKPYEENHPKVNLVKSEGYVTDGLGKTQSSESRLYELSAEDLEKE
EEEEDEDKGGGKDTSTSADAEASEDQNKEPLSKSAKFEKPEEKVPVSSITSNAKESSVKP
TGKVATETQTYETKQGAPTAAAKKIEAKKATRPSKPKGTKETPNKGVQKNPAKNGGFFKK
LAQLLK
Download sequence
Identical sequences YNL173C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]