SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPL221W from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YPL221W
Domain Number - Region: 58-153
Classification Level Classification E-value
Superfamily E set domains 0.035
Family ML domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YPL221W
Sequence length 793
Comment FLC1 ORF Verified Putative FAD transporter; required for uptake of FAD into endoplasmic reticulum; involved in cell wall maintenance
Sequence
MQVLVTLWCLICTCLVLPVAAKKRTLTASSLVTCMENSQLSANSFDVSFSPDDRSLHYDL
DMTTQIDSYIYAYVDVYAYGFKVITENFDVCSMGWKQFCPVHPGNIQIDSIEYIAEKYVK
MIPGIAYQVPDIDAYVRLNIYNNVSENLACIQVFFSNGKTVSQIGVKWVTAVIAGIGLLT
SAVLSTFGNSTAASHISANTMSLFLYFQSVAVVAMQHVDSVPPIAAAWSENLAWSMGLIR
ITFMQKIFRWYVEATGGSASLYLTATTMSVLTQRGLDYLKNTSVYKRAENVLYGNSNTLI
FRGIKRMGYRMKIENTAIVCTGFTFFVLCGYFLAGFIMACKYSIELCIRCGWMRSDRFYQ
FRKNWRSVLKGSLLRYIYIGFTQLTILSFWEFTERDSAGVIVIACLFIVLSCGLMAWAAY
RTIFFASKSVEMYNNPAALLYGDEYVLNKYGFFYTMFNAKHYWWNALLTTYILVKALFVG
FAQASGKTQALAIFIIDLAYFVAIIRYKPYLDRPTNIVNIFICTVTLVNSFLFMFFSNLF
NQKYAVSAIMGWVFFIMNAAFSLLLLLMILAFTTIILFSKNPDSRFKPAKDDRASFQKHA
IPHEGALNKSVANELMALGNVAKDHTENWEYELKSQEGKSEDNLFGVEYDDEKTGTNSEN
AESSSKETTRPTFSEKVLRSLSIKRNKSKLGSFKRSAPDKITQQEVSPDRASSSPNSKSY
PGVSHTRQESEANNGLINAYEDEQFSLMEPSILEDAASSTQVHAMPARDLSLSSVANAQD
VTKKANILDPDYL
Download sequence
Identical sequences YPL221W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]