SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGL045W from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL045W
Domain Number 1 Region: 38-206
Classification Level Classification E-value
Superfamily E set domains 0.00000000112
Family Arrestin/Vps26-like 0.027
Further Details:      
 
Weak hits

Sequence:  YGL045W
Domain Number - Region: 249-310
Classification Level Classification E-value
Superfamily E set domains 0.0084
Family Arrestin/Vps26-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YGL045W
Sequence length 542
Comment RIM8 ORF Verified Protein involved in proteolytic activation of Rim101p in response to alkaline pH; interacts with ESCRT-1 subunits Stp22p and Vps28p; essential for anaerobic growth; member of the arrestin-related trafficking adaptor family
Sequence
MSLLRLWNKESRAPSKIKSHGIVGSYGNSMLAHNNVKQFRIDIDEPHRVWKPNENITGEA
VIDIKRDITNVAIKLSLVCEVRVKTGNSPTSKNKRIEKTLEKSTFLYGQDYVKTAFSAKE
KKPHVDKTTILNGLSKGEHRFPFRIRIPRGRGMLSSIKFERGSITYFLSCTLESLNNING
LKKPEARCEREFAVIVPLDVSRLPKPKTKTVVLQSASMVQNKKNKSTEDESSSYTQLTQK
STTSNSSSSSVNSKTSPLPNKTVTISVDIPQAGFMIGEIIPIDVKIDHYKPFYAPAGLTT
TLVRICRVGGAGKDDPMETFRKDICQSISPIYINPETLQFQSRVYLKVPLDAFSTLTTVG
KFFSFQYYIEVMVNLSKKNVVYTESNRIIGTPIGEQNGLGVENNINRIQRKMLRMVNPET
LENDSEGYESSIFFKDMVNVEKLKRLRNVTGMSIETVIGTTRSEQQQSDASIPSQSSITA
PQNSPSNLRDWLAPLNAYDSDDVPVPKYSPNDKVSVPSEDKQELEQKRLQQLESDPPPCD
DY
Download sequence
Identical sequences YGL045W YGL045W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]