SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL053W from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL053W
Domain Number 1 Region: 44-169
Classification Level Classification E-value
Superfamily E set domains 0.0000308
Family Arrestin/Vps26-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YJL053W
Sequence length 379
Comment PEP8 ORF Verified Vacuolar protein sorting protein that forms part of the multimeric membrane-associated retromer complex along with Vps35p, Vps29p, Vps17p, and Vps5p; essential for endosome-to-Golgi retrograde protein transport
Sequence
MSIFFKPPIDIEILFDNEESRKHVDIATRSSNSSYKSMKESLPVYEDGESLGGIVTLRVR
DSKKVDHLGIKVSVIGSIDMLKSHGSGNSSSKKVNSSTSSSSSNGSVDVRKNSVDQFLCQ
SYDLCPAGELQHSQSFPFLFRDLSKRYESYKGKNVDVAYYVKVTVMRKSTDISKIKRFWV
YLYNSVTTAPNTLSANETKATTNDIAGGNYAADNASDNTQTKSTQGEAADVNQVLPISHS
NNEPKPVRLDIGIENCLHIEFEYAKSQYSLKEVIVGRIYFLLTRLRIKHMELSLITRESS
GLQTSNVMTDSTAIRYEIMDGSSVKGETIPIRLFLSGYDLTPNMSCNYFNVKNYLSLVII
DEDGRRYFKQSEITLYRTR
Download sequence
Identical sequences YJL053W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]