SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL074C from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL074C
Domain Number 1 Region: 487-697
Classification Level Classification E-value
Superfamily Smc hinge domain 1.44e-44
Family Smc hinge domain 0.0007
Further Details:      
 
Domain Number 2 Region: 1-233,1114-1198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.66e-39
Family ABC transporter ATPase domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 895-959,995-1081,1110-1195
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.22e-26
Family ABC transporter ATPase domain-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YJL074C
Sequence length 1200
Comment SMC3 ORF Verified Subunit of the multiprotein cohesin complex required for sister chromatid cohesion in mitotic cells; also required, with Rec8p, for cohesion and recombination during meiosis; phylogenetically conserved SMC chromosomal ATPase family member
Sequence
MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE
RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLND
RNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLK
ASLKKMEETEQKKIQINKEMGELNSKLSEMEQEREELEKYNELERNRKIYQFTLYDRELN
EVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAK
LRESEISQKLTNVNVKIKDVQQQIESNGEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQ
ELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNEL
ESQLQMDRTSLRKQYSAIDEEIEELIDSINGPDTKGQFEDFDSELIHLKQKLSESLDTRK
ELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTL
GELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDS
DVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAIT
LDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELEFVRNELNDIDTKID
QVNANIRKVSNDRESVLTNIEIYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQE
KLNTFENDLLQEFDSELSKEEKERLESLTKEISAAHNKLNITSDALEGITTTIDSLNAEL
ESKLIPQENDLESKMSEVGDAFIFGLQDELKELQLEKESVEKQHENAVLELSTVQREIES
LIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTRREELQQRIREIGLL
PEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELD
ESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHD
ESIDVDMDAESNESQNGKDNEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALIL
AIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRC
Download sequence
Identical sequences YJL074C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]