SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL084C from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL084C
Domain Number 1 Region: 263-353
Classification Level Classification E-value
Superfamily E set domains 0.0000238
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YJL084C
Sequence length 771
Comment ALY2 ORF Verified Protein proposed to regulate the endocytosis of plasma membrane proteins; interacts with the cyclin Pcl7p and ubiquitin ligase Rsp5p; phosphorylated by the cyclin-CDK complex, Pcl7p-Pho85p; mRNA is cell cycle regulated, peaking in M phase
Sequence
MPMDQSISSPLFPMEKDIDIPLNATPLAQSSSLQLFIHLAEPVVFLQGFDPQKTEYPSVV
LRGCLVVRILKPTKLKSISLSFKGYSRTEWPEGIPPKRQEFVEIKDIVDHTWALYPPTEQ
KSKKKMGASAPNESNNAANNFLTKESGASLYRTLSDNETITSRKNSISGLSSLNLSPLGT
PGNSSVNVKDRESRQRSRSSSVTSSNGPSRNLSPINLLKRATSPSVSHHNYKPTTTSIFS
DLLNNTFTHNDAASHHGHHIPTSSNHLAMTSNNFTSGSGGEFFVFQPGDYIYAFEELIPQ
AYPESIKADFGFVEYFLFASIERPGAFKSNISARQVVNIVRTQANNSVEESEPIIISRDW
ENQLYYDIVIASKDIILDAFLPITFKFAPLDKVTLHRIRIYVTETMEYYCREKKVHRMEP
TKKFLLTEQKGPKLPNLPNDANLSKAKNMGNLLQDPKNGDLVNKEYEYQIFIPSRFNNHQ
QLHPDTSYENIKANHWIKICLRLSRVVDNKRKHYEISIDSPIHVLHRLCSHANTLLPSYD
GHPASFPKETDSSISSILESSDDNINLYHNSNIFFPKEVLSSPVLSPNVQPLDILIPHLP
STSLTRNSRQFNRNSKSHPSDNTIFNSAKLKSNIYQPESLQRELASPQAIPLSPITSPMS
NMEVPPPDFDFSSDFISDAASGTTTTEVSSSESSILPRDPPSYKDTVLHDNNQKRRPNSK
HPTPPSLKASHPNKNSDKNSSETLNKKESMSKIEENKHKRETTPKKREIGT
Download sequence
Identical sequences YJL084C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]