SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDL093W from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL093W
Domain Number 1 Region: 322-508
Classification Level Classification E-value
Superfamily MIR domain 7.19e-58
Family MIR domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDL093W
Sequence length 743
Comment PMT5 ORF Verified Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine/threonine residues; acts in a complex with Pmt3p, can instead interact with Pmt2p in some conditions; target for new antifungals
Sequence
MNNEHLLKVDPIPDVTIKRGPLRSFLITKPCDNLSSLRTVTSSKEKLLVGCLLIFTTIVR
LHNISLPNSVVFGENEVGTFVSQYVNNIFFTDVHPPLVAMLYATVSSVFGYKGLFNYGNI
GTEYTANVPYVAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAAICAVCFAIENSFVTLSR
FTLIEGPFVFFMACAVYFFRRSELYLPNSCKANKSLLAASIALGFAVSSKWAGLFTIAWA
GIIVLWRVWFMIGDLSRPIGSSIKYMAFHFTCLLAIPAFIYFLIFSVHIKTLNVNGISSS
FFPAEFRKTLKYNNVIKETVAEVAVGSAVSLNHVGTAGGYLHSHLHNYPAGSMQQQVTLY
PHIDQNNKWIIELAEHPNENVTSFQNLTDGTIIKLRQLKNGCRLHSHDHKPPVSQNADWQ
KEVSCYGYEGFEGDINDDWIIEIDKKRSEPGPAQEHIRAIETKFRLKHYLTGCYLFSHPE
KLPEWGFGQQEVTCAYFAREDLTSWYIEENENEISLPNPEKVSYKKMSFWQKFVAIHKFM
FYLNNYMDTSHAYSSEPKTWPLMLRGIDFWNENGREVYFLGNAVLWWSVTAFICTFIIGV
AVELLAWKLGVNILRDKHIINFHYQVFQYLLGFAAHYFPYFFVGQKLFLYDYLPAYYFGI
LAFGHALDLISTYISNKRNNTGYIMVAIFMVVCFYFFSEHSPLIYATGWSSNLCKRSKWL
GSWDFYCNSLLLSDSHYELNAES
Download sequence
Identical sequences A0A0L8VT49
YDL093W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]