SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim01g097910.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim01g097910.0.1
Domain Number 1 Region: 107-173
Classification Level Classification E-value
Superfamily Rubredoxin-like 2.17e-19
Family Rubredoxin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim01g097910.0.1
Sequence length 206
Sequence
MASATSRASFTFNLSSSPSLTQPSTLKTKTHLTLPPFHIKSHSVSSFYRYPKPQFNLQPK
SIDVSQEDKPISEQPITETPTSESEQEQEEEEKFDSRRLEEKFAVLNTGIYECRSCGYKY
NEATGDPSYPIPPGLPFDKLPEDWRCATCGAAKSFFDSKSVEIAGFAQNQQYGLGGNTLT
SGQKALLIYGGLLLGFVFFLSGYFLQ
Download sequence
Identical sequences K4B0H8
XP_004230127.1.44838 Solyc01g097910.2.1 Solyc01g097910.2.1 Sopim01g097910.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]