SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sopim06g076790.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim06g076790.0.1
Domain Number 1 Region: 30-106
Classification Level Classification E-value
Superfamily TSP9-like 6.67e-22
Family TSP9-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim06g076790.0.1
Sequence length 106
Sequence
MASLNMFVSPIATVTAQQHRSRVYTAATASKSSGGSTEEKSLLDFILGALQKQDQLLETD
PLLKKVEDKSVSTTSSGRKNSVAVPPKKNSNGGGFAGFGGLFNKKD
Download sequence
Identical sequences K4CA37
XP_004241176.1.44838 Solyc06g076790.1.1 Sopim06g076790.0.1 Solyc06g076790.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]