SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim12g006340.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim12g006340.0.1
Domain Number 1 Region: 113-188
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-29
Family B3 DNA binding domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim12g006340.0.1
Sequence length 195
Sequence
MKVSTSGFNSQPEEGEKKSLNSELWHACAGPLVSLPHVGTRVVYFPQGHSEQVAASTNKE
LNGHIPSYPGLPPQLICQLHNVTMDADVETDEVYAQMTLQPLTPQEQKDVCLLPAELGTP
SKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPVQELIGKDLHGNEWKF
RHIFRGEFLFRELIE
Download sequence
Identical sequences K4DBH1
Solyc12g006340.1.1 XP_010313687.1.44838 Solyc12g006340.1.1 Sopim12g006340.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]