SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPR189W from Saccharomyces cerevisiae T73

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR189W
Domain Number 1 Region: 638-790
Classification Level Classification E-value
Superfamily TPR-like 2.47e-23
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 
Domain Number 2 Region: 944-1069
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000231
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Domain Number 3 Region: 488-663
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000208
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 4 Region: 19-94,404-445
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 0.00000000445
Family Protein prenylyltransferase 0.012
Further Details:      
 
Domain Number 5 Region: 1129-1278
Classification Level Classification E-value
Superfamily TPR-like 0.0000000645
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPR189W
Sequence length 1432
Comment SKI3 ORF Verified Ski complex component and TPR protein, mediates 3'-5' RNA degradation by the cytoplasmic exosome; null mutants have superkiller phenotype of increased viral dsRNAs and are synthetic lethal with mutations in 5'-3' mRNA decay
Sequence
MSDIKQLLKEAKQELTNRDYEETIEISEKVLKLDPDNYFAHIFLGKALSSLPASNNVSSN
RNLERATNHYVSAAKLVPDNLLAWKGLFLLFRTTEVVPDILSYDEYFDPCGQYADALLKQ
EQSQVELINDIKLLKKTHPDCQKAFYQHLKPGSLMAETIGRHLSTPQDALLNLIKILSNI
ETTEIGKTLSQNRLKLKASDPDYQIKLNSFSWEIIKNSEIDQLYNQLVNILADDQKRSEI
ENQWLEYRIKVLKSMPLDVKKDFFTKVKEMVEDMVLVNHQSLLAWQKYFEWTDYEDLDNM
DAPLIIKYFKKFPKDPLAMILYSWLSSKLSKYDIKSLESANKPPEGHKKTEKETDIKDVD
ETNEDEVKDRVEDEVKDRVEDEVKDQDEEAKEDEEEDLDDIEIGLLEEEVVTVLTENIVK
CKNNILAHRILCQYYLLTKEYEAALPYIKNGISLIAYNIKDLGVHLPLTKREFSLDLATV
YTYVDAPKDHNAALKLYDNILSGDFSNIQAKMGKGIIFIERKNWKDAMTLLTQVHEQSPN
NLEVLSELSWSKAHMGYMDEALAGLDTVIKGIKGMDLRSIDFRALNLWRQAKVYIMKHAS
INDAKQENVKCAFKLLIQSIKILDTFAPGFSTLGDIYCHYYKDHLRAFKCYFKAFDLDAG
DYTAAKYITETYASKPNWQAASSIASRLIKGEKAKAELRSNNWPFRVVGIAHLEKQEESD
SIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTFAQYFKAISL
CDVGEYLESLDILEKVCQEAATEESFQIGLVEVLMRCSLDLYSQGFLLKSVSIAKDTIER
IKIIISELKCENQQVWIYLSQVLRLFIWIESKVDTLPVESLVSIFENSQFSGSEEIDSVD
NIKIDTLLDSTTDDNVSIACKFLILASKYSVSDQKFTDIAGTVRASYWYNIGISELTAFI
TLKEPQYRDAAIFAFKKSIQLQSNTSETWIGLGIATMDINFRVSQHCFIKATALEPKATN
TWFNLAMLGLKKKDTEFAQQVLNKLQSLAPQDSSPWLGMALILEEQGDIIGSSKLFAHSF
ILSNGRSKAAQFMYAKNVLENHINNGDDGRDIETVEKLTTASIALEQFFKKSPDSQFALQ
CALLTLERLHHYENANELANRLIGILEKKFEKTQDERELFNFAIIKGQFARIHLGLGNFE
LSIENADLSQGIISESSDEKSMKTKISNHICLGLSYFFLNDFDQTLNQFQELLSISKDSK
HLVVLIAKVLYDVGESDTKEIALQELTEYIATSGADLLVTLTIAAMSILDDKREDLSIIL
EELKALPLSKQIIDKHKDAPYLIEEITKRLYRNDTGKQVWQRSAYFFPNNLKVWERLDKN
IQRRIASNGQNKVTAEEMSKLYCESKNLRSIQRGMFLCPWNVTAVKALNECF
Download sequence
Identical sequences YPR189W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]