SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBL084C from Saccharomyces cerevisiae T73

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL084C
Domain Number 1 Region: 532-738
Classification Level Classification E-value
Superfamily TPR-like 3.16e-44
Family Tetratricopeptide repeat (TPR) 0.003
Further Details:      
 
Domain Number 2 Region: 428-579
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000474
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 
Weak hits

Sequence:  YBL084C
Domain Number - Region: 66-200
Classification Level Classification E-value
Superfamily TPR-like 0.000759
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YBL084C
Sequence length 753
Comment CDC27 ORF Verified Subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition
Sequence
MAVNPELAPFTLSRGIPSFDDQALSTIIQLQDCIQQAIQQLNYSTAEFLAELLYAECSIL
DKSSVYWSDAVYLYALSLFLNKSYHTAFQISKEFKEYHLGIAYIFGRCALQLSQGVNEAI
LTLLSIINVFSSNSSNTRINMVLNSNLVHIPDLATLNCLLGNLYMKLDHSKEGAFYHSEA
LAINPYLWESYEAICKMRATVDLKRVFFDIAGKKSNSHNNNAASSFPSTSLSHFEPRSQP
SLYSKTNKNGNNNINNNVNTLFQSSNSPPSTSASSFSSIQHFSRSQQQQANTSIRTCQNK
NTQTPKNPAINSKTSSALPNNISMNLVSPSSKQPTISSLAKVYNRNKLLTTPPSKLLNND
RNHQNNNNNNNNNNNNNNNNNNNIINKTTFKTPRNLYSSTGRLTTSKKNPRSLIISNSIL
TSDYSITLPEIMYNFALILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEI
INYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCC
IGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDP
QHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYY
ELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGR
KKDAIKELTVAMNLDPKGNQVIIDELQKCHMQE
Download sequence
Identical sequences YBL084C YBL084C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]