SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJR088C from Saccharomyces cerevisiae T73

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR088C
Domain Number 1 Region: 87-123,152-257
Classification Level Classification E-value
Superfamily TPR-like 0.00000000447
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YJR088C
Sequence length 292
Comment EMC2 ORF Verified Member of a transmembrane complex required for efficient folding of proteins in the ER; null mutant displays induction of the unfolded protein response
Sequence
MLKDLVREKLLTIMNTKAYTQFNPEQLLQLENEMKIYMKSGDSGLTEGNYFFLMEMLFYV
LVYRNQDVDAQVVYNTLRDRLGENSYKMVIMKATLLQINGNDKGAIEYLENLLNDDLEYE
TDFVTYVSIAKKLIAIKTTSKNLSQESVLKEVVALTDKFPLDAELWWYASEIYFEMGQFE
KARYCLEQVLCITPFNYACFGRLSETLYYEALRSKKQTKTELLEKALKNALRSVELSELY
LKGWALVNIISRELGRNKQNDLIKLSASKLNEISAKSNNKDKITAELILNKI
Download sequence
Identical sequences A6ZQ43 C7GMB9 E7NJG9
tr|A6ZQ43|A6ZQ43_YEAS7 YJR088C YJR088C YJR088C YJR088C YJR088C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]